Recombinant Kluyveromyces lactis Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)
This Recombinant Kluyveromyces lactis Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17) spans the amino acid sequence from region 34-196.
Product Specifications
Product Name Alternative
Presequence translocated-associated motor subunit PAM17, mitochondrial
UniProt
Q6CXR8
Expression Region
34-196
Origin
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
RMNSTNAGKTASHEMTWPEFFKLRKKERVFNTASSVATAIVFVNGSWFYFSTLEIDPTQT IFGFDPLMAITAGMITCAAVGWLLGPIVGTALFKATSGPKLLQFQEKQLSFLAKIQKNRV NPQSQSFSNPVPDYYGEKINSIPQYRQWLRDCHSYKRKASEFL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC050391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400994-500 1x 500 µL
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470012-500 1x 500 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details