Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0114 protein BCI_0033 (BCI_0033)

This Recombinant UPF0114 protein BCI_0033 (BCI_0033) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

UPF0114 protein BCI_0033

UniProt

Q1LU52

Expression Region

1-164

Origin

Baumannia cicadellinicola subsp. Homalodisca coagulata

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKIIEKMIYESRWLLFPVYIGLSFGFILLTLKFFHEIIQFLPKIFDMPESDLILIVLSM IDIALVGGLLVMVMFSGYENFILKMSDDCNQKRLNWMGKMDVNSIKNKVASSIVAISSVH LLRIFMEADRTRDNKIMWCVIIHLAFVLSAFGMAYIDKMSKTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF555 conjugate, 0.1mg/mL
BNC552748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF488A conjugate, 0.1mg/mL
BNC880949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details