Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C3orf18 homolog

This Recombinant Mouse Uncharacterized protein C3orf18 homolog spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf18 homolog

UniProt

Q8BGK9

Expression Region

1-164

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTSFNDTRIPDVAGGAAG VGTMLLSFGIITVIGLAVAMVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHG RDAASMQAAASLQVTQGKSTLPSQGPLQRPSRLVFTDVANAIHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFC1B Human Gene Knockout Kit (CRISPR)
KN416675 1 Kit

CFC1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Bone: femur, lateral
CR562126 5 µg

Tissue Total RNA, Bone: femur, lateral

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), 1mg/mL
BNUM2701-50 1x 50 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), 1mg/mL

Sign In for Pricing
View Details
UBQLN3 (C-term) Rabbit Polyclonal Antibody
AP12099PU-N 400 µL

UBQLN3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isopropyl-tartronic Acid Diethyl Ester
TRC-I873570-500MG 500 mg

Isopropyl-tartronic Acid Diethyl Ester

Sign In for Pricing
View Details
Recombinant Rat IL-2 Protein (Halo Tag)
PDMR100104-01 20 µg

Recombinant Rat IL-2 Protein (Halo Tag)

Sign In for Pricing
View Details