Recombinant Mouse Uncharacterized protein C3orf18 homolog
This Recombinant Mouse Uncharacterized protein C3orf18 homolog spans the amino acid sequence from region 1-164.
Product Specifications
Product Name Alternative
Uncharacterized protein C3orf18 homolog
UniProt
Q8BGK9
Expression Region
1-164
Origin
Mus musculus (Mouse)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTSFNDTRIPDVAGGAAG VGTMLLSFGIITVIGLAVAMVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHG RDAASMQAAASLQVTQGKSTLPSQGPLQRPSRLVFTDVANAIHA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942098-500 1x 500 µL
Catenin, beta (CTNNB1) (CTNNB1/2098), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP325664L 1 mg
alpha 1 Antitrypsin (SERPINA1) (NM_001127707) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC882106-100 1x 100 µL
Replication Protein A2 (RPA2) (RPA2/2106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details