Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf45 (C3orf45)

This Recombinant Human Uncharacterized protein C3orf45 (C3orf45) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf45

UniProt

Q8N112

Expression Region

1-164

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGT LRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLLLLALLVLTCLVLALLAVYLS VLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAAT1 (SLC1A3) Rabbit Monoclonal Antibody
TA423094 100 µL

EAAT1 (SLC1A3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Sodium DL-Lactate (60% w/w in H2O)
TRC-S644003-5G 5 g

Sodium DL-Lactate (60% w/w in H2O)

Sign In for Pricing
View Details
Guanosine-1',2',3',4',5'-13C5 hydrate
TRC-G837913-1MG 1 mg

Guanosine-1',2',3',4',5'-13C5 hydrate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (T385A) (His Tag)
PKSV030442 100 µg

Recombinant SARS-CoV-2 Spike RBD (T385A) (His Tag)

Sign In for Pricing
View Details
Psg27 Mouse Gene Knockout Kit (CRISPR)
KN514084 1 Kit

Psg27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), Biotin conjugate, 0.1mg/mL
BNCB2416-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details