Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf45 (C3orf45)

This Recombinant Human Uncharacterized protein C3orf45 (C3orf45) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf45

UniProt

Q8N112

Expression Region

1-164

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGT LRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLLLLALLVLTCLVLALLAVYLS VLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), Biotin conjugate, 0.1mg/mL
BNCB1670-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]
TA809004AM 100 µL

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

Sign In for Pricing
View Details
Mouse Tn-I (Troponin I) ELISA Kit
E-EL-M0086-01 24 Tests

Mouse Tn-I (Troponin I) ELISA Kit

Sign In for Pricing
View Details
Mouse Tn-I (Troponin I) ELISA Kit
E-EL-M0086-02 48 Tests

Mouse Tn-I (Troponin I) ELISA Kit

Sign In for Pricing
View Details
Mouse Tn-I (Troponin I) ELISA Kit
E-EL-M0086-03 96 Tests

Mouse Tn-I (Troponin I) ELISA Kit

Sign In for Pricing
View Details
1-(4,5-Dihydro-2-thiazolyl)-3-azetidinethiol Hydrochloride
TRC-D454190-250MG 250 mg

1-(4,5-Dihydro-2-thiazolyl)-3-azetidinethiol Hydrochloride

Sign In for Pricing
View Details