Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 234 (TMEM234)

This Recombinant Human Transmembrane protein 234 (TMEM234) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Transmembrane protein 234

UniProt

Q8WY98

Expression Region

1-164

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMP FLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVI GISLCITSSVPWTAELQLHGKGQLQTLSQKCKREASGTQSERFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brevibacillus brevis NADH-quinone oxidoreductase subunit K (nuoK)
orb2934452-01 20 µg

Recombinant Brevibacillus brevis NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Brevibacillus brevis NADH-quinone oxidoreductase subunit K (nuoK)
orb2934452-02 100 µg

Recombinant Brevibacillus brevis NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
CYP1A2 (Cytochrome p450 1A2, CP12, P3-450, P450(PA)) (MaxLight 405)
MBS6413433-01 0.1 mL

CYP1A2 (Cytochrome p450 1A2, CP12, P3-450, P450(PA)) (MaxLight 405)

Sign In for Pricing
View Details
CYP1A2 (Cytochrome p450 1A2, CP12, P3-450, P450(PA)) (MaxLight 405)
MBS6413433-02 5x 0.1 mL

CYP1A2 (Cytochrome p450 1A2, CP12, P3-450, P450(PA)) (MaxLight 405)

Sign In for Pricing
View Details
INPP5J Rabbit Polyclonal Antibody (Biotin)
orb2123107 100 µL

INPP5J Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Mouse Nogo-66 Receptor/Reticulon 4 Receptor/NgR/RTN4R (C-Fc)
CM16-500ug 500 µg

Recombinant Mouse Nogo-66 Receptor/Reticulon 4 Receptor/NgR/RTN4R (C-Fc)

Sign In for Pricing
View Details