Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus equi subsp. zooepidemicus ATP synthase subunit b (atpF)

This Recombinant Streptococcus equi subsp. zooepidemicus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B4U2D7

Expression Region

1-164

Origin

Streptococcus equi subsp. zooepidemicus (strain MGCS10565)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVTIGELIGNFILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQ QLEKEGQANLEASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAVALTDIEHSKSE AISAVKTEMSDLTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-n-octyldichlorotin
TRC-D481755-5G 5 g

Di-n-octyldichlorotin

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS800296 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Biotin TCO
#96050 1x 1 mg

Biotin TCO

Sign In for Pricing
View Details
ERK2 Mouse Monoclonal Antibody [C3B12]
EM1901-55 100 µL

ERK2 Mouse Monoclonal Antibody [C3B12]

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS800609 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
VTI1B Polyclonal Antibody
E-AB-52425-01 20 µL

VTI1B Polyclonal Antibody

Sign In for Pricing
View Details