Recombinant Streptococcus equi subsp. zooepidemicus ATP synthase subunit b (atpF)
This Recombinant Streptococcus equi subsp. zooepidemicus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-164.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
B4U2D7
Expression Region
1-164
Origin
Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSVTIGELIGNFILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQ QLEKEGQANLEASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAVALTDIEHSKSE AISAVKTEMSDLTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941228-500 1x 500 µL
CD6 (C6/372 + 3F7B5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941788-500 1x 500 µL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882245-100 1x 100 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 