Recombinant Emericella nidulans Presequence translocated-associated motor subunit pam17, mitochondrial (pam17)
This Recombinant Emericella nidulans Presequence translocated-associated motor subunit pam17, mitochondrial (pam17) spans the amino acid sequence from region 88-252.
Product Specifications
Product Name Alternative
Presequence translocated-associated motor subunit pam17, mitochondrial
UniProt
C8VTR5
Expression Region
88-252
Origin
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
NSTTSTSAREEAAKLDWNSYFKLRASRRRYTLASSIVSSAVSTVVGVQVLSSQNLENLGA QVMGLDPFVVLGMATAACGAVGWLVGPFLGNAVWGLVNRSYKKAFLVKEKEFFDRIKRYR VDPSSNSMTNPVPDYYGEKIGSVQGYRQWLKDQRAYNRKRRSFIK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680096-100 1x 100 µL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741081-500 1x 500 µL
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details