Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yitM (yitM)

This Recombinant Bacillus subtilis Uncharacterized protein yitM (yitM) spans the amino acid sequence from region 30-194.

Product Specifications

Product Name Alternative

Uncharacterized protein yitM

UniProt

O06748

Expression Region

30-194

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KQLEYSGEEIFKGFVFAQGEVGKQLPEVFNKAMTDKLNTKQAKAFANQVVADIKKEDADF FDNLKKAVYSKDALKVDELLKKAGQIVEEKVEAAKEIAASKDDTSRVQAELVNTVDTANY FYYVSYVAAAGALILIILAIDITPIAISDNVDREMAIRTLVDELN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EML4 Antibody [DyLight 350]
NBP1-05974UV 0.1 mL

Rabbit Polyclonal EML4 Antibody [DyLight 350]

Sign In for Pricing
View Details
Dpagt1 (NM_007875) Mouse Tagged ORF Clone
MG206451 10 µg

Dpagt1 (NM_007875) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GTPBP10 Rabbit Polyclonal Antibody
orb5886-01 50 μL

GTPBP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTPBP10 Rabbit Polyclonal Antibody
orb5886-02 100 µL

GTPBP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTPBP10 Rabbit Polyclonal Antibody
orb5886-03 200 µL

GTPBP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Cyclopropylcycloheptan-1-amine hydrochloride
YPD40717-01 50 mg

1-Cyclopropylcycloheptan-1-amine hydrochloride

Sign In for Pricing
View Details