Recombinant UPF0114 protein in repA1-repA2 intergenic region
This Recombinant UPF0114 protein in repA1-repA2 intergenic region spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
UPF0114 protein in repA1-repA2 intergenic region
UniProt
O31289
Expression Region
1-165
Origin
Buchnera aphidicola subsp. Thelaxes suberi
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEKRIANIIYSSRWLMFPVYIGLAFGFVLLTVKFFQQIICVIPEILTMSESGLVLIVLSL IDIALVGGLLVMVMFSGYENFIAKMETTENKKRLSWMGTMDVNSIKNKVASSIVAISSVH LLRLFMDADKISDNKIMWCVVIHLTFVLSAFGMAYIDKMSKKHYS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880146-100 1x 100 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details