Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 084L (IIV6-084L)

This Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 084L (IIV6-084L) spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

Uncharacterized protein 084L

UniProt

O55715

Expression Region

1-165

Origin

Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKVIKINLIVNKRMSPAIILIGVLILIVLFVIKFNSSEVSSILTSEVTSEGDDEHETET RETTGCISQLNTLRATLAAKKKELKTLRTARKKECTEQLAKTQAEVDRIQAKIDNFSSRT KIVPLPGGEVGPPYNPPPPRTNTRPNPRPNPRPAQLPQLYNYGYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF640R conjugate, 0.1mg/mL
BNC402501-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2501), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF405S conjugate, 0.1mg/mL
BNC041563-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL
BNC742094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details