Recombinant Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic (FCPA)
This Recombinant Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic (FCPA) spans the amino acid sequence from region 32-196.
Product Specifications
Product Name Alternative
Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic
UniProt
Q08584
Expression Region
32-196
Origin
Phaeodactylum tricornutum
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
AFENEIGAQQPLGYWDPLGLVADGNQEKFDRLRYVEIKHGRICMLAVAGYLTQEAGIRLP GDIDYSGTSFESIPNGFAALSAVPGAGIAQIIAFIGFFEIAVMKDITGGEFVGDFRNNYL DFGWDTFSEDKKLQKRAIELNQGRAAQMGILALMVHEQLGVSILP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-500 1x 500 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042220-500 1x 500 µL
CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470918-500 1x 500 µL
CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881126-100 1x 100 µL
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details