Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R119 (MIMI_R119)
This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R119 (MIMI_R119) spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
Uncharacterized protein R119
UniProt
Q5UPJ5
Expression Region
1-165
Origin
Acanthamoeba polyphaga mimivirus (APMV)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLDSENTISENNDVRINNINLIASIVLWLLFVITVIGTFKPIHRVSMESNFSKYYKYTY CVDDKCTCVDYFTYGKVTIYCYNKNSVNCLAINWDNVGIIVILIFMLMIIMNGFYQMMKQ KISVEDLVIMNQQLEYQRQNRMNNLYYHDNYGNLRMRMPGDYGYY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683779-500 1x 500 µL
MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY402859 100 µg
EPS15R (EPS15L1) (NM_021235) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNCB1815-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details