Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein C14orf180 homolog

This Recombinant Mouse Transmembrane protein C14orf180 homolog spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

Transmembrane protein C14orf180 homolog

UniProt

Q8BNX7

Expression Region

1-165

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSAARVSRSNSHPRTRHPTRENEGTTWGSQPSRTERDGDRKCPPSILRPRRQECGCHGG EPQKTSRHVRFREPLEVAVHYIARKDTTAAIKVPSRPASHGGSPLQPASCSGSLFLWLTL CALLGVVLVLYCGQAKRVTAALEDLLAQLLALILRLWRVVLACWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (C5/473), CF568 conjugate, 0.1mg/mL
BNC680473-500 1x 500 µL

CD5 (C5/473), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF568 conjugate, 0.1mg/mL
BNC681239-100 1x 100 µL

Napsin-A (NAPSA/1239), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 1mg/mL
BNUM1073-50 1x 50 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 1mg/mL

Sign In for Pricing
View Details