Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0114 protein in repA1-repA2 intergenic region

This Recombinant UPF0114 protein in repA1-repA2 intergenic region spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

UPF0114 protein in repA1-repA2 intergenic region

UniProt

Q9F4E2

Expression Region

1-165

Origin

Buchnera aphidicola subsp. Geoica urticularia

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLIEKIIYASRWLMFPVYIGLSFGFILLTLKFFQQIILVIPKILIMSESGLILIVLSL IDIALVGGLLVMVMFSGYENFISKMEINVDKKKLGWMGTMDVNSIKNKVASSIVAISSVH LLRLFMDADKISNDKIMWCVIIHLTFVLSAFGMACIDKMSKKNYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Muscle tissue
CS700438 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
Cpe Mouse Gene Knockout Kit (CRISPR)
KN503748 1 Kit

Cpe Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AquaphileTM Coelenterazine h, lyophilized solid
#10127-50ug 1x 50 µg

AquaphileTM Coelenterazine h, lyophilized solid

Sign In for Pricing
View Details
Human HSD17B11 activation kit by CRISPRa
GA109622 1 Kit

Human HSD17B11 activation kit by CRISPRa

Sign In for Pricing
View Details
4-(4-Bromo-3-formylphenoxy)benzonitrile
TRC-B700800-500MG 500 mg

4-(4-Bromo-3-formylphenoxy)benzonitrile

Sign In for Pricing
View Details
2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride
TRC-D367020-50MG 50 mg

2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride

Sign In for Pricing
View Details