Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 9B (TMEM9B)

This Recombinant Human Transmembrane protein 9B (TMEM9B) spans the amino acid sequence from region 34-198.

Product Specifications

Product Name Alternative

Transmembrane protein 9B

UniProt

Q9NQ34

Expression Region

34-198

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKY EERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFA NAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF3 / E2A (TCF3) Human Gene Knockout Kit (CRISPR)
KN415432 1 Kit

TCF3 / E2A (TCF3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF405S conjugate, 0.1mg/mL
BNC040763-500 1x 500 µL

CD34 (HPCA1/763), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker), Biotin conjugate, 0.1mg/mL
BNCB1655-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-threo-Hex-2-enaric acid 1,4-Lactone
TRC-H294830-5MG 5 mg

L-threo-Hex-2-enaric acid 1,4-Lactone

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-1), CF740 conjugate, 0.1mg/mL
BNC742258-100 1x 100 µL

Lactoylglutathione Lyase (CPTC-GLO1-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
O-Benzylhydroxylamine Hydrochloride
TRC-B279080-5G 5 g

O-Benzylhydroxylamine Hydrochloride

Sign In for Pricing
View Details