Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR300C (YBR300C)
This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR300C (YBR300C) spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
Putative uncharacterized protein YBR300C
UniProt
P38362
Expression Region
1-165
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAATPAAIEVSLTIVFVLFFSADVSLTRNSEMKAHTSKMDSYSSSIYMNVLPTSLAQTSY HLAPISHLKCLSVQFSSHIHYSYYYGASVLERCVFHRSRIRGARFIVPIPFIAFPRHKNV FSQCTYFRRIPLGCLQRCSCSFWPRKSQNQICFEPSLRGHLIFVL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400146-100 1x 100 µL
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880012-500 1x 500 µL
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401154-100 1x 100 µL
Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details