Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD)
This Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD) spans the amino acid sequence from region 32-197.
Product Specifications
Product Name Alternative
Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic
UniProt
Q08587
Expression Region
32-197
Origin
Phaeodactylum tricornutum
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
AFEDELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVVGYLVQEAGVRLP GTIDYSGKTFAEIPSLAAFKEIPAGGLVQLLFFIGVLESSVMRDLTGEAEFVGDFRNGAI DFGWDTFDEETQFKKRAIELNQGRAAQMGILALMVHEQLGVSLLPQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
043138 200 µL
TOR1B, ID (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B)
Sign In for Pricing
View Details 
T1848-45A-FITC 100 µL
TBX21 (T-box Transcription Factor TBX21, T-box Protein 21, Transcription Factor TBLYM, T-cell-specific T-box Transcription Factor T-bet, TBET, TBLYM) (Azide Free) (FITC)
Sign In for Pricing
View Details