Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD)

This Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD) spans the amino acid sequence from region 32-197.

Product Specifications

Product Name Alternative

Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic

UniProt

Q08587

Expression Region

32-197

Origin

Phaeodactylum tricornutum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFEDELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVVGYLVQEAGVRLP GTIDYSGKTFAEIPSLAAFKEIPAGGLVQLLFFIGVLESSVMRDLTGEAEFVGDFRNGAI DFGWDTFDEETQFKKRAIELNQGRAAQMGILALMVHEQLGVSLLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Zinc finger protein 292 (ZNF292) , partial
MBS1175772 Inquire

Recombinant Human Zinc finger protein 292 (ZNF292) , partial

Sign In for Pricing
View Details
GJA1 ELISA Kit (Mouse) (OKCD02478)
OKCD02478 96 Well

GJA1 ELISA Kit (Mouse) (OKCD02478)

Sign In for Pricing
View Details
Amph-set siRNA/shRNA/RNAi Lentivector (Mouse)
11853094 4x 500 ng

Amph-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
(3,3,3-Trifluoropropyl) trichlorosilane 97%
T23995-01 5 g

(3,3,3-Trifluoropropyl) trichlorosilane 97%

Sign In for Pricing
View Details
(3,3,3-Trifluoropropyl) trichlorosilane 97%
T23995-02 25 g

(3,3,3-Trifluoropropyl) trichlorosilane 97%

Sign In for Pricing
View Details
(3,3,3-Trifluoropropyl) trichlorosilane 97%
T23995-03 100 g

(3,3,3-Trifluoropropyl) trichlorosilane 97%

Sign In for Pricing
View Details