Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD)

This Recombinant Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD) spans the amino acid sequence from region 32-197.

Product Specifications

Product Name Alternative

Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic

UniProt

Q08587

Expression Region

32-197

Origin

Phaeodactylum tricornutum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFEDELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVVGYLVQEAGVRLP GTIDYSGKTFAEIPSLAAFKEIPAGGLVQLLFFIGVLESSVMRDLTGEAEFVGDFRNGAI DFGWDTFDEETQFKKRAIELNQGRAAQMGILALMVHEQLGVSLLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCA1 (NM_003069) Human Tagged Lenti ORF Clone
RC218308L4 10 µg

SMARCA1 (NM_003069) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Canine Alanine Aminotransferase,ALT;GPT ELISA KIT
JOT-EK0256Ca-01 96 Well

Canine Alanine Aminotransferase,ALT;GPT ELISA KIT

Sign In for Pricing
View Details
Canine Alanine Aminotransferase,ALT;GPT ELISA KIT
JOT-EK0256Ca-02 48 Well

Canine Alanine Aminotransferase,ALT;GPT ELISA KIT

Sign In for Pricing
View Details
Lentiviral human EEF2K sgRNA gene knockout kit - Lentiviral human EEF2K sgRNA gene knockout kit (25)
GTR15368919 1 Vial

Lentiviral human EEF2K sgRNA gene knockout kit - Lentiviral human EEF2K sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
USP9YP35 Adenovirus (Human)
49375051 1.0 mL

USP9YP35 Adenovirus (Human)

Sign In for Pricing
View Details
Tau Mouse mAb
C05518-20ul 20 µL

Tau Mouse mAb

Sign In for Pricing
View Details