Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic (FCPE)

This Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic (FCPE) spans the amino acid sequence from region 32-197.

Product Specifications

Product Name Alternative

Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic

UniProt

Q41093

Expression Region

32-197

Origin

Phaeodactylum tricornutum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFENELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVAGYLVQENGIRLP GDIDYSGTSFESIPNGFAALTTISGAGIAQIVAFIGFLELAVMKDITGGEFVGDFRNDFI DFGWDSFDEETKMQKRAIELNQGRAAQMGILALMVHEQLGVSLIPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA1 Knockout 143B Polyclonal Cells
ARG11868 1 Million

FOXA1 Knockout 143B Polyclonal Cells

Sign In for Pricing
View Details
Olfactory receptor 2T10 rabbit pAb Antibody
orb767600-01 50 μL

Olfactory receptor 2T10 rabbit pAb Antibody

Sign In for Pricing
View Details
Olfactory receptor 2T10 rabbit pAb Antibody
orb767600-02 100 µL

Olfactory receptor 2T10 rabbit pAb Antibody

Sign In for Pricing
View Details
LSM10 Over-expression Lysate Product
GWB-13157C 0.1 mg

LSM10 Over-expression Lysate Product

Sign In for Pricing
View Details
SOCS-1 Antibody
251895 0.1 mg

SOCS-1 Antibody

Sign In for Pricing
View Details
Accuris qMAX Probe, No Rox qPCR Mix, sample, 20 reactions
PR2001-N-S 1 Each

Accuris qMAX Probe, No Rox qPCR Mix, sample, 20 reactions

Sign In for Pricing
View Details