Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic (FCPE)

This Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic (FCPE) spans the amino acid sequence from region 32-197.

Product Specifications

Product Name Alternative

Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic

UniProt

Q41093

Expression Region

32-197

Origin

Phaeodactylum tricornutum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFENELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVAGYLVQENGIRLP GDIDYSGTSFESIPNGFAALTTISGAGIAQIVAFIGFLELAVMKDITGGEFVGDFRNDFI DFGWDSFDEETKMQKRAIELNQGRAAQMGILALMVHEQLGVSLIPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPP-1 hydrochloride
T83724-01 1 mg

TPP-1 hydrochloride

Sign In for Pricing
View Details
TPP-1 hydrochloride
T83724-02 5 mg

TPP-1 hydrochloride

Sign In for Pricing
View Details
TPP-1 hydrochloride
T83724-03 10 mg

TPP-1 hydrochloride

Sign In for Pricing
View Details
TPP-1 hydrochloride
T83724-04 25 mg

TPP-1 hydrochloride

Sign In for Pricing
View Details
4-ESTREN-4-FLUORO-17β-OL-3-ONE
503672 Inquire

4-ESTREN-4-FLUORO-17β-OL-3-ONE

Sign In for Pricing
View Details
HTRA3 (HtrA Serine Peptidase 3, Prsp, Tasp) (Biotin)
247336-Biotin 100 µL

HTRA3 (HtrA Serine Peptidase 3, Prsp, Tasp) (Biotin)

Sign In for Pricing
View Details