Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-166.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

Q669A0

Expression Region

1-166

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSA RMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRI GALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3B (MAP1LC3B) Rabbit Polyclonal Antibody
TA372308 100 µL

LC3B (MAP1LC3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD68 (C68/684), CF740 conjugate, 0.1mg/mL
BNC740684-100 1x 100 µL

CD68 (C68/684), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ARHGAP22 activation kit by CRISPRa
GA111785 1 Kit

Human ARHGAP22 activation kit by CRISPRa

Sign In for Pricing
View Details
ZKSCAN3 Human Gene Knockout Kit (CRISPR)
KN202971RB 1 Kit

ZKSCAN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ssbp2 Mouse Gene Knockout Kit (CRISPR)
KN516757 1 Kit

Ssbp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexokinase II (HK2) Human Gene Knockout Kit (CRISPR)
KN209482BN 1 Kit

Hexokinase II (HK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details