Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus johnsonii ATP synthase subunit b (atpF)

This Recombinant Lactobacillus johnsonii ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-166.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q74K19

Expression Region

1-166

Origin

Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFMFAALKLELGDTLYYLLIFAALLLLVKHFAWGPVTKMMEERRQKVISDLDQAESDRK KAELLANQREAALKDSKQEATQILSTAKSNAEKTKNNIISQADQEAAAIRKRASEDAAQA KTDALNEARDQVADISVAIAEKVISKNLSAADQKDLVDQFIKGLND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM229A (Center) Rabbit Polyclonal Antibody
AP54194PU-N 400 µL

TMEM229A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desmuslin (SYNM) Mouse Monoclonal Antibody [Clone ID: OTI5G1]
CF806553 100 µg

Desmuslin (SYNM) Mouse Monoclonal Antibody [Clone ID: OTI5G1]

Sign In for Pricing
View Details
CD45RB (DF-B1), CF647 conjugate, 0.1mg/mL
BNC471066-100 1x 100 µL

CD45RB (DF-B1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTDN1 (MPLKIP) (NM_138701) Human Recombinant Protein
TP761264 50 µg

TTDN1 (MPLKIP) (NM_138701) Human Recombinant Protein

Sign In for Pricing
View Details
1,2-Diethylnaphthalene
TRC-D478120-50MG 50 mg

1,2-Diethylnaphthalene

Sign In for Pricing
View Details
Human LRRC39 activation kit by CRISPRa
GA114998 1 Kit

Human LRRC39 activation kit by CRISPRa

Sign In for Pricing
View Details