Recombinant Schizosaccharomyces pombe Uncharacterized protein C630.04c (SPAC630.04c)
This Recombinant Schizosaccharomyces pombe Uncharacterized protein C630.04c (SPAC630.04c) spans the amino acid sequence from region 1-166.
Product Specifications
Product Name Alternative
Uncharacterized protein C630.04c
UniProt
Q9UUH8
Expression Region
1-166
Origin
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGEEISAIDLVMANDQLVSTSDASDIPYDPYSQFWGKVLVLTFGIICVVFVIFMLHHERI KACRTIISAREQQRTQHSIHRRERSSSGASQQFEHHVRQTDCLPLYEPITALNQQYLKTL PTTSTPPPPAIFDENGEFVGDVPSVAGAIERPPSYESLPAPQNDEV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470698-500 1x 500 µL
Chromogranin A (LK2H10 + PHE5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740848-500 1x 500 µL
CD31 / PECAM-1 (C31.10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details