Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter capsulatus ATP synthase subunit b (atpF)

This Recombinant Rhodobacter capsulatus ATP synthase subunit b (atpF) spans the amino acid sequence from region 20-185.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

O05333

Expression Region

20-185

Origin

Rhodobacter capsulatus (Rhodopseudomonas capsulata)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EGPFVSLRNAHFVILVAFLIFVGVLIKFKVPSMLLGMLDKRAEGIKADLDEAKALRDEAQ KILASYERKAREVQGQADEIVAAAKRDAQLAAEQAKADLKEAIARRLKGAEDRIASAEAA ALKDVKDRAVQVAVAAAAEVLANQMSASDKSGMIDAAITEVETRLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF488A conjugate, 0.1mg/mL
BNC882342-100 1x 100 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2030R), CF405S conjugate, 0.1mg/mL
BNC042030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details