Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Penicillium marneffei Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

This Recombinant Penicillium marneffei Altered inheritance of mitochondria protein 31, mitochondrial (aim31) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 31, mitochondrial

UniProt

B6QHL9

Expression Region

1-167

Origin

Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCSDFEEETSIQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNRMFRARIYA QFFTLLAVVAGGMYYKTERKQRREFEKKVEERKAQEKRDAWLRELEARDKEDKGWKERHA AVSVTAKKETEGAVDKNVNQAPTEEVVEKRGTGILDAVKALVQGKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF405S conjugate, 0.1mg/mL
BNC040874-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791), CF647 conjugate, 0.1mg/mL
BNC470791-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF640R conjugate, 0.1mg/mL
BNC400245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (CDK1/873), CF568 conjugate, 0.1mg/mL
BNC680873-500 1x 500 µL

P34 / cdk1 (CDK1/873), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details