Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Cell number regulator 3 (CNR3)

This Recombinant Zea mays Cell number regulator 3 (CNR3) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Cell number regulator 3, ZmCNR03

UniProt

D9HP19

Expression Region

1-167

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYPATTPYETASGVGVAPVAGLFPVAGEAREWSSRLLDCFDDFDICCMTFWCPCITFGRT AEIVDHGMTSCGTSAALFALIQWLSGSQCTWAFSCTYRTRLRAQHGLPEAPCADFLVHLC CLHCALCQEYRELKARGYEPVLGWEFNAQRAAAGVAMCPPASQGMGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

all-trans-Geranyl Citronellol
TRC-G367300-25MG 25 mg

all-trans-Geranyl Citronellol

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), 0.2mg/mL
BNUB3548-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), 0.2mg/mL

Sign In for Pricing
View Details
Human CTTNBP2 activation kit by CRISPRa
GA113333 1 Kit

Human CTTNBP2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (rLAMP4/824), CF740 conjugate, 0.1mg/mL
BNC743434-500 1x 500 µL

CD68 (Macrophage Marker) (rLAMP4/824), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTG1 (Center) Rabbit Polyclonal Antibody
AP52764PU-N 400 µL

MTG1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details