Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Cell number regulator 3 (CNR3)

This Recombinant Zea mays Cell number regulator 3 (CNR3) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Cell number regulator 3, ZmCNR03

UniProt

D9HP19

Expression Region

1-167

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYPATTPYETASGVGVAPVAGLFPVAGEAREWSSRLLDCFDDFDICCMTFWCPCITFGRT AEIVDHGMTSCGTSAALFALIQWLSGSQCTWAFSCTYRTRLRAQHGLPEAPCADFLVHLC CLHCALCQEYRELKARGYEPVLGWEFNAQRAAAGVAMCPPASQGMGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP1A1 (NM_000499) Human Over-expression Lysate
LY400170 100 µg

CYP1A1 (NM_000499) Human Over-expression Lysate

Sign In for Pricing
View Details
IL36G Antibody
KC-1582-01 50 μL

IL36G Antibody

Sign In for Pricing
View Details
IL36G Antibody
KC-1582-02 100 µL

IL36G Antibody

Sign In for Pricing
View Details
IL36G Antibody
KC-1582-03 1 mL

IL36G Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS628311 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
CD10 Recombinant Rabbit monoclonal Antibody
HA750273 100 µL

CD10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details