Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sporulation membrane protein ytrI (ytrI)

This Recombinant Bacillus subtilis Sporulation membrane protein ytrI (ytrI) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Sporulation membrane protein ytrI

UniProt

O34460

Expression Region

1-167

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVPQHYKKPGWQRFFAGMMCGAVISWFFFLFTYGTFQEEQVSLIEKQKEHVKDLNNQIS IYQEDLHKLNEDNKRKLLIQSVSVKLLNGDKYKISQPDKTKFEEHVKDDISEVITKDIES VYQTKDLLKRTIENKVYMINEKKYEATVRELIIYTRLTVELEISFAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF488A conjugate, 0.1mg/mL
BNC882651-100 1x 100 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF740 conjugate, 0.1mg/mL
BNC742460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF640R conjugate, 0.1mg/mL
BNC400870-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF594 conjugate, 0.1mg/mL
BNC940142-500 1x 500 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details