Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP)

This Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Uncharacterized protein yjcP

UniProt

O31638

Expression Region

1-167

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKQKNNKKKNIEKRNIEKRNIEEKNNEDLEELENAIYTYHKKELLAFFLEKTRIGHDKE EYKRFQSLLYKLDIECLEFAISRFSHIDIIHDHSKYVPAFIPLFAAYLTMFFNFYEKHWG ALSFAAGTIAAIVWIIAVERKHRNQAISIMKIFEQVKERKVKDRSKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf88 (KNOP1) Rabbit Polyclonal Antibody
TA372140 100 µL

C16orf88 (KNOP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 568 Anti-human CD4 Antibody *SK3*
100420B0-AAT 100 Tests

IFluor® 568 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
AKR1D1 (NM_005989) Human Recombinant Protein
TP323056M 100 µg

AKR1D1 (NM_005989) Human Recombinant Protein

Sign In for Pricing
View Details
Texas Red Conjugated Narcissus pseudonarcissus Lectin (Daffodil) -NPA-
T-8006-1 1 mg

Texas Red Conjugated Narcissus pseudonarcissus Lectin (Daffodil) -NPA-

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS809462 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Recombinant COPS3 Antibody
RC-15998-01 50 μL

Recombinant COPS3 Antibody

Sign In for Pricing
View Details