Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP)

This Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Uncharacterized protein yjcP

UniProt

O31638

Expression Region

1-167

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKQKNNKKKNIEKRNIEKRNIEEKNNEDLEELENAIYTYHKKELLAFFLEKTRIGHDKE EYKRFQSLLYKLDIECLEFAISRFSHIDIIHDHSKYVPAFIPLFAAYLTMFFNFYEKHWG ALSFAAGTIAAIVWIIAVERKHRNQAISIMKIFEQVKERKVKDRSKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREM (C-term) Rabbit Polyclonal Antibody
AP51077PU-N 400 µL

CREM (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Naphthylacetyl Spermine Trihydrochloride
TRC-N377800-250MG 250 mg

1-Naphthylacetyl Spermine Trihydrochloride

Sign In for Pricing
View Details
2-(4-Bromo-2-chlorophenyl)ethanol
TRC-B682245-50MG 50 mg

2-(4-Bromo-2-chlorophenyl)ethanol

Sign In for Pricing
View Details
RBM6 Antibody
8C10790-AAT 50 µg

RBM6 Antibody

Sign In for Pricing
View Details
6-Oxo-L-pipecolic Acid
TRC-O858815-500MG 500 mg

6-Oxo-L-pipecolic Acid

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), Biotin conjugate, 0.1mg/mL
BNCB1692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details