Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP)

This Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Uncharacterized protein yjcP

UniProt

O31638

Expression Region

1-167

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKQKNNKKKNIEKRNIEKRNIEEKNNEDLEELENAIYTYHKKELLAFFLEKTRIGHDKE EYKRFQSLLYKLDIECLEFAISRFSHIDIIHDHSKYVPAFIPLFAAYLTMFFNFYEKHWG ALSFAAGTIAAIVWIIAVERKHRNQAISIMKIFEQVKERKVKDRSKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Concanavalin A, CF®488A Conjugate
#29016 5x 1 mg

Concanavalin A, CF®488A Conjugate

Sign In for Pricing
View Details
Benchtop Shaking Incubator BSBT-1704
BSBT-1704 1 Unit

Benchtop Shaking Incubator BSBT-1704

Sign In for Pricing
View Details
Anti-LM ActA
Y123237 100 µL

Anti-LM ActA

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (ZL7-4), CF568 conjugate, 0.1mg/mL
BNC681627-500 1x 500 µL

CD79a (B-Cell Marker) (ZL7-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR1470 Human qPCR Primer Pair (MI0007075)
HP300164 200 Reactions

MIR1470 Human qPCR Primer Pair (MI0007075)

Sign In for Pricing
View Details
TMPRSS11A Rabbit Polyclonal Antibody
TA369415 100 µL

TMPRSS11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details