Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0114 protein in repA1-repA2 intergenic region (BUsg_PL2)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0114 protein in repA1-repA2 intergenic region (BUsg_PL2) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

UPF0114 protein in repA1-repA2 intergenic region

UniProt

O85061

Expression Region

1-167

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKIIEKSIYASRWLMFPVYVGLSFGFILLTLKFFQQIIFIIPDILAMSESGLVLAVLSL IDIALVGGLLVMVMFSGYENFISKMDIQDNEKRLGWMGTMDVNSIKNKVASSIVAISSVH LLRLFMEAERILDNKIMLCVIIRLTFVLSAFGMAYIDKMSKKKDNLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF740 conjugate, 0.1mg/mL
BNC741718-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF647 conjugate, 0.1mg/mL
BNC470018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL
BNC940521-100 1x 100 µL

AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details