Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1161 (MJ1161)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1161 (MJ1161) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1161

UniProt

Q58561

Expression Region

1-167

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRDNIRSINKLLIYLVLILSAMFLCQNVFAEDYNAIEITVKNISSGEILYQKIFPKDEAF SDYQVINGFTIDIHYNPNYPGMVYKVHQSNNHFIFNVSGELNWGSYQQSGDIACIVDVIH YDFPPPSNTTSNTTTTSSSSTKAPIPLSVYLAITAFFTYIIYRKSKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV663110 1.0 µg DNA

TARS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ACE2-set siRNA/shRNA/RNAi Lentivector (Human)
11167091 4x 500 ng

ACE2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
HRP-Pig IgG
C050113-1ml 1ml

HRP-Pig IgG

Sign In for Pricing
View Details
Rat Heat Shock Protein 47 (HSP47) ELISA Kit
orb1946974-01 48 Tests

Rat Heat Shock Protein 47 (HSP47) ELISA Kit

Sign In for Pricing
View Details
Rat Heat Shock Protein 47 (HSP47) ELISA Kit
orb1946974-02 96 Tests

Rat Heat Shock Protein 47 (HSP47) ELISA Kit

Sign In for Pricing
View Details
Constant temperature incubator
E3291 1 Unit

Constant temperature incubator

Sign In for Pricing
View Details