Recombinant Rhizobium meliloti Nitrogen fixation protein fixH (fixH)
This Recombinant Rhizobium meliloti Nitrogen fixation protein fixH (fixH) spans the amino acid sequence from region 1-167.
Product Specifications
Product Name Alternative
Nitrogen fixation protein fixH
UniProt
P18397
Expression Region
1-167
Origin
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSTATKQRSPKRGFTGWHMVAVMSLFFGTVISVNLVMAWNASRSWSGLVVENTYVASQQF NGKVAEGRAFQASGIKGRLTTEPGAIRYVLTRNGEPEQKIDKVIAVLKRPVEEHEDLRVE LHPRGEGAFVLAEELKPGQWIAAMMAMAGDAVVHRQTIRFIAEGRDK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details