Recombinant Thermotoga maritima Uncharacterized protein TM_1467.1 (TM_1467.1)
This Recombinant Thermotoga maritima Uncharacterized protein TM_1467.1 (TM_1467.1) spans the amino acid sequence from region 1-168.
Product Specifications
Product Name Alternative
Uncharacterized protein TM_1467.1
UniProt
P58010
Expression Region
1-168
Origin
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MMIDVFLIALLLSILTGNIKNVLKYNYKGLYLFAIPFVLQLLPWKEILVPLSFVMLFLFF IWNRNIPGFKLMAIGAVLNGFTMSVNGGKMPVWEPTLKLLNLDLDFKHTAFTEFSWKTLL ADYIPVYLPWGRKFVISVGDILVFIGVFIFFVLKPRFQTQPSRVPHES
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040158-100 1x 100 µL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details