Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0114 protein PC1_0431 (PC1_0431)

This Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0114 protein PC1_0431 (PC1_0431) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

UPF0114 protein PC1_0431

UniProt

C6DJS4

Expression Region

1-168

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERFIENLMYTSRWLLAPVYLGLSLGLLALAIKFFQEVFHVLPNIFDIAEADLVLVLLSL IDMTLVGGLLVMVMLSGYENFVSALDITDGREKLNWLGKMDSGSLKNKVAASIVAISSIH LLRVFMDARNIPDNKLMWYVIIHLTFVLSALVMGYLDRMSRYEKSKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL
BNC401154-100 1x 100 µL

Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details