Recombinant Aquifex aeolicus Uncharacterized protein aq_1900 (aq_1900)
This Recombinant Aquifex aeolicus Uncharacterized protein aq_1900 (aq_1900) spans the amino acid sequence from region 1-168.
Product Specifications
Product Name Alternative
Uncharacterized protein aq_1900
UniProt
O67738
Expression Region
1-168
Origin
Aquifex aeolicus (strain VF5)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKRIIALLFFFLIAFGYSLSPEEEKQLIRDIAEIKATLKTFMEQTDKRFQDLNQRINELR EDMNKRFEQVDKRFEQVDKRFEQINNELNRLIQIMVGIFAGQIALVAAVIGFAWWDRRTI IRKSKEETFEEMEKELRPEKFKKLLNALREKAKTDKELEAILKKYGLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881700-500 1x 500 µL
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400791-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details