Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 31 (TMEM31)

This Recombinant Human Transmembrane protein 31 (TMEM31) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Transmembrane protein 31

UniProt

Q5JXX7

Expression Region

1-168

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLTEKSEGEQQLKPNNSNAPNEDQEEEIQQSEQHTPARQRTQRADTQPSRCRLPSRRTP TTSSDRTINLLEVLPWPTEWIFNPYRLPALFELYPEFLLVFKEAFHDISHCLKAQMEKIG LPIILHLFALSTLYFYKFFLPTILSLSFFILLVLLLLLFIIVFILIFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIFAB (NM_001099221) Human Over-expression Lysate
LC420371 20 µg

TIFAB (NM_001099221) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS651144 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (N/A), 0.2mg/mL
BNUB1736-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human S100A12/CAGC Protein
PKSH033538-01 10 µg

Recombinant Human S100A12/CAGC Protein

Sign In for Pricing
View Details
Recombinant Human S100A12/CAGC Protein
PKSH033538-02 50 µg

Recombinant Human S100A12/CAGC Protein

Sign In for Pricing
View Details
HDAC10 Antibody
8C0222-AAT 50 µg

HDAC10 Antibody

Sign In for Pricing
View Details