Recombinant Phaeosphaeria nodorum Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)
This Recombinant Phaeosphaeria nodorum Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-168.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
Q0V4P1
Expression Region
1-168
Origin
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAGMGPPNSAPLPSSFDENADFYNENTIDKIWRRFREEPLIPFGCGLTAWAIVGASRSMR KGDHKMTNLYFRRRLYAQSFTIAVLVIGNLYWQKDRVKRKDYERMKAETERKEKRDRWLR ELEMRDEEDKAWKERLAKKTRGAADEAKGVTDMVAEKTKELKDQTLGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040023-500 1x 500 µL
Thyroglobulin (2H11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA751314 100 µL
Phospho-STING (S366) Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details