Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288353 (DDB_G0288353)

This Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288353 (DDB_G0288353) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Putative uncharacterized transmembrane protein DDB_G0288353

UniProt

Q54J19

Expression Region

1-168

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIPNLHNSIPICGKCDPKLTNSFIGIVLFLAVLIIGILILILFYYNKEINKNSSQYLPI HSPGSGNPSPSSSFLINNNNNNNNYHQNNNSNNNNIIYNPYYNSSTTSPYYLSPNSNHNP SLILYHQSRLLGNIHSINSINNNNNNNNNNPPTNISNKLNKNGETKNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF594 conjugate, 0.1mg/mL
BNC942579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), CF640R conjugate, 0.1mg/mL
BNC400753-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL
BNC940948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF740 conjugate, 0.1mg/mL
BNC741930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP3 (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400408-500 1x 500 µL

TIMP3 (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details