Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris ATP synthase subunit b (atpF)

This Recombinant Lactococcus lactis subsp. cremoris ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q02XA1

Expression Region

1-168

Origin

Lactococcus lactis subsp. cremoris (strain SK11)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLLLEAAPNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEAN NKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIE QERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Anti-human/ non-human primates CD89 Antibody *A59*
108901J0-AAT 100 Tests

TRITC Anti-human/ non-human primates CD89 Antibody *A59*

Sign In for Pricing
View Details
TCAB1 Polyclonal Antibody
MBS9238475-01 0.1 mL

TCAB1 Polyclonal Antibody

Sign In for Pricing
View Details
TCAB1 Polyclonal Antibody
MBS9238475-02 5x 0.1 mL

TCAB1 Polyclonal Antibody

Sign In for Pricing
View Details
ANKMY1 Antibody, FITC conjugated
A70499-100UG 100 µg

ANKMY1 Antibody, FITC conjugated

Sign In for Pricing
View Details
SHIP-2 (B-9)
sc-515211 200 µg/mL

SHIP-2 (B-9)

Sign In for Pricing
View Details
RPL32 Rabbit Polyclonal Antibody (PE)
orb2593696 100 µg

RPL32 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details