Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris ATP synthase subunit b (atpF)

This Recombinant Lactococcus lactis subsp. cremoris ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P0A2Z1

Expression Region

1-168

Origin

Lactococcus lactis subsp. cremoris (strain MG1363)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLLLEAAPNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEAN NKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIE QERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK1
E8EM1709-30 100 µL

DLK1

Sign In for Pricing
View Details
Human Sialic acid (SA) ELISA Kit
GA-E1637HM-01 48 Tests

Human Sialic acid (SA) ELISA Kit

Sign In for Pricing
View Details
Human Sialic acid (SA) ELISA Kit
GA-E1637HM-02 96 Tests

Human Sialic acid (SA) ELISA Kit

Sign In for Pricing
View Details
AMIGO1 (NM_020703) Human Over-expression Lysate
LS057463 100 µg

AMIGO1 (NM_020703) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-LUC7L2 antibody
PAab04889 100 µg

Anti-LUC7L2 antibody

Sign In for Pricing
View Details
MEK1 (MAP2K1) Mouse Monoclonal Antibody [Clone ID: LBI1B4]
AMM13618V 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody [Clone ID: LBI1B4]

Sign In for Pricing
View Details