Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21)
This Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21) spans the amino acid sequence from region 71-239.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit TIM21
UniProt
P53220
Expression Region
71-239
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDD GITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAK ESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-500 1x 500 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472598-100 1x 100 µL
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details