Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salinibacter ruber ATP synthase subunit b (atpF)

This Recombinant Salinibacter ruber ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2S434

Expression Region

1-169

Origin

Salinibacter ruber (strain DSM 13855 / M31)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTALFAQSLVTPSVGLIFWKTVAFLIFLYILYRFGWGPITESLEEREEEIEHSIQRAEEA LEEAKAIQAENEEARREAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIE REKQAALQELRDEVADLAIEAAQKIIENDLDADRHRQLVDDALDDFPTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Acetyl Rhein
TRC-A187705-5MG 5 mg

5-Acetyl Rhein

Sign In for Pricing
View Details
Eph receptor A3 (EPHA3) (C-term) Rabbit Polyclonal Antibody
AP14277PU-N 400 µL

Eph receptor A3 (EPHA3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Transmembrane Protein 175 (TMEM175) (NM_001297425) Human Tagged ORF Clone
RG238133 10 µg

Transmembrane Protein 175 (TMEM175) (NM_001297425) Human Tagged ORF Clone

Sign In for Pricing
View Details
CTNNBL1 (NM_030877) Human Recombinant Protein
TP324836 20 µg

CTNNBL1 (NM_030877) Human Recombinant Protein

Sign In for Pricing
View Details
Basic Water Purification System BBPS-203
BBPS-203 Each

Basic Water Purification System BBPS-203

Sign In for Pricing
View Details
Pyrantel Pamoate
TRC-P840575-250MG 250 mg

Pyrantel Pamoate

Sign In for Pricing
View Details