Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides ethenogenes ATP synthase subunit b (atpF)

This Recombinant Dehalococcoides ethenogenes ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q3Z8Z6

Expression Region

1-169

Origin

Dehalococcoides ethenogenes (strain 195)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLAELGINIPSFIAQVVNFGLLLGLLYLFAYKPILAKLDERSARIKESMERTDQVKEQ AQRAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEARAEAEAMLSRARTEIRQER DEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLENSTNLRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etilefrin Hydrochloride
TRC-E932950-250MG 250 mg

Etilefrin Hydrochloride

Sign In for Pricing
View Details
Alpha Actinin 4 / ACTN4 (93), CF640R conjugate, 0.1mg/mL
BNC403450-500 1x 500 µL

Alpha Actinin 4 / ACTN4 (93), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ExoBriteTM 640/660 CTB EV Staining Kit, 500 labelings
#30114 1 Kit

ExoBriteTM 640/660 CTB EV Staining Kit, 500 labelings

Sign In for Pricing
View Details
3,5,6-Trichloro-8-quinolinecarboxylic Acid
TRC-T774285-5MG 5 mg

3,5,6-Trichloro-8-quinolinecarboxylic Acid

Sign In for Pricing
View Details
HSD11B1 (NM_005525) Human Over-expression Lysate
LC401695 20 µg

HSD11B1 (NM_005525) Human Over-expression Lysate

Sign In for Pricing
View Details
HYAL3 Polyclonal Antibody
E-AB-11316-01 20 µL

HYAL3 Polyclonal Antibody

Sign In for Pricing
View Details