Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides ethenogenes ATP synthase subunit b (atpF)

This Recombinant Dehalococcoides ethenogenes ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q3Z8Z6

Expression Region

1-169

Origin

Dehalococcoides ethenogenes (strain 195)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLAELGINIPSFIAQVVNFGLLLGLLYLFAYKPILAKLDERSARIKESMERTDQVKEQ AQRAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEARAEAEAMLSRARTEIRQER DEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLENSTNLRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT5 Mouse Monoclonal Antibody [Clone ID: OTI1B5]
CF809321 100 µg

TRMT5 Mouse Monoclonal Antibody [Clone ID: OTI1B5]

Sign In for Pricing
View Details
RAC1 Human Gene Knockout Kit (CRISPR)
KN208711 1 Kit

RAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diglycolic anhydride
TRC-D446338-250MG 250 mg

Diglycolic anhydride

Sign In for Pricing
View Details
Recombinant Syntaxin Binding Protein 1 Antibody
RC-16156-01 50 μL

Recombinant Syntaxin Binding Protein 1 Antibody

Sign In for Pricing
View Details
Recombinant Syntaxin Binding Protein 1 Antibody
RC-16156-02 100 µL

Recombinant Syntaxin Binding Protein 1 Antibody

Sign In for Pricing
View Details
Recombinant Syntaxin Binding Protein 1 Antibody
RC-16156-03 1 mL

Recombinant Syntaxin Binding Protein 1 Antibody

Sign In for Pricing
View Details